SCOPe 2.08: Domain d1tzlg2: 1tzl G:355-552

Lineage for d1tzlg2 (1tzl G:355-552)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.1: GMC oxidoreductases [54374] (5 proteins)

6. Protein Pyranose 2-oxidase [117843] (1 species)

7. Species White-rot fungus (Peniophora sp. SG) [TaxId:204723] [117844] (5 PDB entries)
   Uniprot Q8J136 43-619

8. Domain d1tzlg2: 1tzl G:355-552 [112889]
   Other proteins in same PDB: d1tzla1, d1tzlb1, d1tzlc1, d1tzld1, d1tzle1, d1tzlf1, d1tzlg1, d1tzlh1
   complexed with fad

Details for d1tzlg2

PDB Entry: 1tzl, 2.35 Å

PDB Description: crystal structure of pyranose 2-oxidase from the white-rot fungus peniophora sp.

PDB Compounds: (G:) Pyranose oxidase

SCOPe Domain Sequences for d1tzlg2:

Sequence; same for both SEQRES and ATOM records:

>d1tzlg2 d.16.1.1 (G:355-552) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]}
yiteqslvfcqtvmstelidsvksdmtirgtpgeltysvtytpgastnkhpdwwnekvkn
hmmqhqedplpipfedpepqvttlfqpshpwhtqihrdafsygavqqsidsrlivdwrff
grtepkeenklwfsdkitdaynmpqptfdfrfpagrtskeaedmmtdmcvmsakiggflp
gslpqfmepglvlhlggt

Timeline for d1tzlg2:

• d1tzlg2 first appeared in SCOP 1.71
  
• d1tzlg2 appears in SCOPe 2.07