| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) ![]() N-terminal domain is beta/beta/alpha common fold |
| Family d.16.1.1: GMC oxidoreductases [54374] (5 proteins) |
| Protein Pyranose 2-oxidase [117843] (1 species) |
| Species White-rot fungus (Peniophora sp. SG) [TaxId:204723] [117844] (5 PDB entries) |
| Domain d1tzlf2: 1tzl F:355-552 [112887] Other proteins in same PDB: d1tzla1, d1tzlb1, d1tzlc1, d1tzld1, d1tzle1, d1tzlf1, d1tzlg1, d1tzlh1 |
PDB Entry: 1tzl (more details), 2.35 Å
SCOP Domain Sequences for d1tzlf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tzlf2 d.16.1.1 (F:355-552) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]}
yiteqslvfcqtvmstelidsvksdmtirgtpgeltysvtytpgastnkhpdwwnekvkn
hmmqhqedplpipfedpepqvttlfqpshpwhtqihrdafsygavqqsidsrlivdwrff
grtepkeenklwfsdkitdaynmpqptfdfrfpagrtskeaedmmtdmcvmsakiggflp
gslpqfmepglvlhlggt
Timeline for d1tzlf2: