Lineage for d1tzlc2 (1tzl C:355-552)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 599429Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 599430Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 599431Family d.16.1.1: GMC oxidoreductases [54374] (5 proteins)
  6. 599464Protein Pyranose 2-oxidase [117843] (1 species)
  7. 599465Species White-rot fungus (Peniophora sp. SG) [TaxId:204723] [117844] (1 PDB entry)
  8. 599468Domain d1tzlc2: 1tzl C:355-552 [112881]
    Other proteins in same PDB: d1tzla1, d1tzlb1, d1tzlc1, d1tzld1, d1tzle1, d1tzlf1, d1tzlg1, d1tzlh1

Details for d1tzlc2

PDB Entry: 1tzl (more details), 2.35 Å

PDB Description: crystal structure of pyranose 2-oxidase from the white-rot fungus peniophora sp.

SCOP Domain Sequences for d1tzlc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tzlc2 d.16.1.1 (C:355-552) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG)}
yiteqslvfcqtvmstelidsvksdmtirgtpgeltysvtytpgastnkhpdwwnekvkn
hmmqhqedplpipfedpepqvttlfqpshpwhtqihrdafsygavqqsidsrlivdwrff
grtepkeenklwfsdkitdaynmpqptfdfrfpagrtskeaedmmtdmcvmsakiggflp
gslpqfmepglvlhlggt

SCOP Domain Coordinates for d1tzlc2:

Click to download the PDB-style file with coordinates for d1tzlc2.
(The format of our PDB-style files is described here.)

Timeline for d1tzlc2: