Lineage for d1tzlc1 (1tzl C:43-354,C:553-619)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 576286Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 576287Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 576341Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (14 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 576513Protein Pyranose 2-oxidase [117439] (1 species)
  7. 576514Species White-rot fungus (Peniophora sp. SG) [TaxId:204723] [117440] (1 PDB entry)
  8. 576517Domain d1tzlc1: 1tzl C:43-354,C:553-619 [112880]
    Other proteins in same PDB: d1tzla2, d1tzlb2, d1tzlc2, d1tzld2, d1tzle2, d1tzlf2, d1tzlg2, d1tzlh2

Details for d1tzlc1

PDB Entry: 1tzl (more details), 2.35 Å

PDB Description: crystal structure of pyranose 2-oxidase from the white-rot fungus peniophora sp.

SCOP Domain Sequences for d1tzlc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tzlc1 c.3.1.2 (C:43-354,C:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG)}
mdikydvvivgsgpigctyarelvgagykvamfdigeidsglkigahkkntveyqknidk
fvnviqgqlmsvsvpvntlvvdtlsptswqastffvrngsnpeqdplrnlsgqavtrvvg
gmsthwtcatprfdreqrpllvkddadaddaewdrlytkaesyfqtgtdqfkesirhnlv
lnklaeeykgqrdfqqiplaatrrsptfvewssantvfdlqnrpntdapeerfnlfpava
cervvrnalnseieslhihdlisgdrfeikadvyvltagavhntqllvnsgfgqlgrpnp
tnppellpslgsXhrmgfdekednccvntdsrvfgfknlflggcgniptayganptltam
slaiksceyikqnftpspft

SCOP Domain Coordinates for d1tzlc1:

Click to download the PDB-style file with coordinates for d1tzlc1.
(The format of our PDB-style files is described here.)

Timeline for d1tzlc1: