![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
![]() | Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) ![]() N-terminal domain is beta/beta/alpha common fold |
![]() | Family d.16.1.1: GMC oxidoreductases [54374] (5 proteins) |
![]() | Protein Pyranose 2-oxidase [117843] (1 species) |
![]() | Species White-rot fungus (Peniophora sp. SG) [TaxId:204723] [117844] (1 PDB entry) |
![]() | Domain d1tzlb2: 1tzl B:355-552 [112879] Other proteins in same PDB: d1tzla1, d1tzlb1, d1tzlc1, d1tzld1, d1tzle1, d1tzlf1, d1tzlg1, d1tzlh1 |
PDB Entry: 1tzl (more details), 2.35 Å
SCOP Domain Sequences for d1tzlb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tzlb2 d.16.1.1 (B:355-552) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG)} yiteqslvfcqtvmstelidsvksdmtirgtpgeltysvtytpgastnkhpdwwnekvkn hmmqhqedplpipfedpepqvttlfqpshpwhtqihrdafsygavqqsidsrlivdwrff grtepkeenklwfsdkitdaynmpqptfdfrfpagrtskeaedmmtdmcvmsakiggflp gslpqfmepglvlhlggt
Timeline for d1tzlb2: