Lineage for d1tzla2 (1tzl A:355-552)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542330Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 2542331Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 2542332Family d.16.1.1: GMC oxidoreductases [54374] (5 proteins)
  6. 2542373Protein Pyranose 2-oxidase [117843] (1 species)
  7. 2542374Species White-rot fungus (Peniophora sp. SG) [TaxId:204723] [117844] (5 PDB entries)
    Uniprot Q8J136 43-619
  8. 2542393Domain d1tzla2: 1tzl A:355-552 [112877]
    Other proteins in same PDB: d1tzla1, d1tzlb1, d1tzlc1, d1tzld1, d1tzle1, d1tzlf1, d1tzlg1, d1tzlh1
    complexed with fad

Details for d1tzla2

PDB Entry: 1tzl (more details), 2.35 Å

PDB Description: crystal structure of pyranose 2-oxidase from the white-rot fungus peniophora sp.
PDB Compounds: (A:) Pyranose oxidase

SCOPe Domain Sequences for d1tzla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tzla2 d.16.1.1 (A:355-552) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]}
yiteqslvfcqtvmstelidsvksdmtirgtpgeltysvtytpgastnkhpdwwnekvkn
hmmqhqedplpipfedpepqvttlfqpshpwhtqihrdafsygavqqsidsrlivdwrff
grtepkeenklwfsdkitdaynmpqptfdfrfpagrtskeaedmmtdmcvmsakiggflp
gslpqfmepglvlhlggt

SCOPe Domain Coordinates for d1tzla2:

Click to download the PDB-style file with coordinates for d1tzla2.
(The format of our PDB-style files is described here.)

Timeline for d1tzla2: