Lineage for d1tz2c_ (1tz2 C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1874686Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 1874687Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 1874688Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 1874689Protein 1-aminocyclopropane-1-carboxylate deaminase [53694] (3 species)
  7. 1874690Species Pseudomonas sp., strain ACP [TaxId:306] [110722] (6 PDB entries)
    Uniprot Q00740
  8. 1874705Domain d1tz2c_: 1tz2 C: [112858]
    complexed with 1ac, plp

Details for d1tz2c_

PDB Entry: 1tz2 (more details), 2.1 Å

PDB Description: Crystal structure of 1-aminocyclopropane-1-carboyxlate deaminase complexed with ACC
PDB Compounds: (C:) 1-aminocyclopropane-1-carboxylate deaminase

SCOPe Domain Sequences for d1tz2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tz2c_ c.79.1.1 (C:) 1-aminocyclopropane-1-carboxylate deaminase {Pseudomonas sp., strain ACP [TaxId: 306]}
mnlqrfprypltfgptpiqplarlskhlggkvhlyakredcnsglafggnktrkleylip
ealaqgcdtlvsiggiqsnqtrqvaavaahlgmkcvlvqenwvnysdavydrvgniqmsr
ilgadvrlvpdgfdigfrrswedalesvraaggkpyaipagcsdhplgglgfvgfaeevr
aqeaelgfkfdyvvvcsvtgstqagmvvgfaadgradrvigvdasakpaqtreqitriar
qtaekvglerdimradvvlderfagpeyglpnegtleairlcartegmltdpvyegksmh
gmiemvrngefpegsrvlyahlggvpalngysfifrdg

SCOPe Domain Coordinates for d1tz2c_:

Click to download the PDB-style file with coordinates for d1tz2c_.
(The format of our PDB-style files is described here.)

Timeline for d1tz2c_: