Lineage for d1tyya_ (1tyy A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137471Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2137472Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2137473Family c.72.1.1: Ribokinase-like [53614] (10 protein domains)
    automatically mapped to Pfam PF00294
  6. 2137520Protein Aminoimidazole riboside kinase [117720] (1 species)
  7. 2137521Species Salmonella typhimurium [TaxId:90371] [117721] (3 PDB entries)
    Uniprot Q8ZKR2
  8. 2137522Domain d1tyya_: 1tyy A: [112850]
    complexed with k

Details for d1tyya_

PDB Entry: 1tyy (more details), 2.6 Å

PDB Description: Crystal structure of aminoimidazole riboside kinase from Salmonella enterica
PDB Compounds: (A:) putative sugar kinase

SCOPe Domain Sequences for d1tyya_:

Sequence, based on SEQRES records: (download)

>d1tyya_ c.72.1.1 (A:) Aminoimidazole riboside kinase {Salmonella typhimurium [TaxId: 90371]}
nkvwvigdasvdlvpekqnsylkcpggasanvgvcvarlggecgfigclgdddagrflrq
vfqdngvdvtflrldadltsavlivnltadgersftylvhpgadtyvspqdlppfrqyew
fyfssigltdrpareaclegarrmreaggyvlfdvnlrskmwgntdeipeliarsaalas
ickvsadelcqlsgashwqdaryylrdlgcdttiislgadgallitaegefhfpaprvdv
vdttgagdafvggllftlsrancwdhallaeaisnanacgamavtakgamtalpfpdqln
tfls

Sequence, based on observed residues (ATOM records): (download)

>d1tyya_ c.72.1.1 (A:) Aminoimidazole riboside kinase {Salmonella typhimurium [TaxId: 90371]}
nkvwvigdasvdlvpekqnsylkcpggasanvgvcvarlggecgfigclgdddagrflrq
vfqdngvdvtflrldadltsavlivnsftylvhpgadtyvspqdlppfrqyewfyfssig
ltdrpareaclegarrmreaggyvlfdvnlrskmwgntdeipeliarsaalasickvsad
elcqlsgashwqdaryylrdlgcdttiislgadgallitaegefhfpaprvdvvdttgag
dafvggllftlsrancwdhallaeaisnanacgamavtakgamtalpfpdqlntfls

SCOPe Domain Coordinates for d1tyya_:

Click to download the PDB-style file with coordinates for d1tyya_.
(The format of our PDB-style files is described here.)

Timeline for d1tyya_: