Lineage for d1tyqg_ (1tyq G:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2340383Superfamily a.118.13: Arp2/3 complex 16 kDa subunit ARPC5 [69103] (1 family) (S)
    automatically mapped to Pfam PF04699
  5. 2340384Family a.118.13.1: Arp2/3 complex 16 kDa subunit ARPC5 [69104] (2 proteins)
  6. 2340385Protein Arp2/3 complex 16 kDa subunit ARPC5 [69105] (1 species)
  7. 2340386Species Cow (Bos taurus) [TaxId:9913] [69106] (3 PDB entries)
    Uniprot Q9CPW4 # 99% sequence identity
  8. 2340389Domain d1tyqg_: 1tyq G: [112849]
    Other proteins in same PDB: d1tyqa1, d1tyqa2, d1tyqb1, d1tyqc_, d1tyqd1, d1tyqd2, d1tyqe_, d1tyqf_
    complexed with atp, ca

Details for d1tyqg_

PDB Entry: 1tyq (more details), 2.55 Å

PDB Description: Crystal structure of Arp2/3 complex with bound ATP and calcium
PDB Compounds: (G:) Arp2/3 Complex 16kDa Subunit

SCOPe Domain Sequences for d1tyqg_:

Sequence, based on SEQRES records: (download)

>d1tyqg_ a.118.13.1 (G:) Arp2/3 complex 16 kDa subunit ARPC5 {Cow (Bos taurus) [TaxId: 9913]}
frkvdvdeydenkfvdeddggdgqagpdegevdsclrqgnmtaalqaalknppintksqa
vkdragsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqwhe
kalaaggvgsivrvltarktv

Sequence, based on observed residues (ATOM records): (download)

>d1tyqg_ a.118.13.1 (G:) Arp2/3 complex 16 kDa subunit ARPC5 {Cow (Bos taurus) [TaxId: 9913]}
frkvdvdeydenkfvdeagpdegevdsclrqgnmtaalqaalknppintksqavkdrags
ivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqwhekalaagg
vgsivrvltarktv

SCOPe Domain Coordinates for d1tyqg_:

Click to download the PDB-style file with coordinates for d1tyqg_.
(The format of our PDB-style files is described here.)

Timeline for d1tyqg_: