Lineage for d1tyqd2 (1tyq D:121-282)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1228690Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
    alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 1228764Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family) (S)
  5. 1228765Family d.198.2.1: Arp2/3 complex subunits [69646] (2 proteins)
  6. 1228766Protein ARPC2 (34 kDa subunit) [69649] (1 species)
    duplication: tandem repeat of two domains of this fold
  7. 1228767Species Cow (Bos taurus) [TaxId:9913] [69650] (10 PDB entries)
    Uniprot O15144 1-282 # 100% sequence identity
  8. 1228777Domain d1tyqd2: 1tyq D:121-282 [112846]
    Other proteins in same PDB: d1tyqa1, d1tyqa2, d1tyqb1, d1tyqc_, d1tyqe_, d1tyqf_, d1tyqg_
    complexed with atp, ca

Details for d1tyqd2

PDB Entry: 1tyq (more details), 2.55 Å

PDB Description: Crystal structure of Arp2/3 complex with bound ATP and calcium
PDB Compounds: (D:) Arp2/3 complex 34kDa subunit

SCOPe Domain Sequences for d1tyqd2:

Sequence, based on SEQRES records: (download)

>d1tyqd2 d.198.2.1 (D:121-282) ARPC2 (34 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]}
fasvfekyfqfqeegkegenravihyrddetmyveskkdrvtvvfstvfkddddvvigkv
fmqefkegrrashtapqvlfshrepplelkdtdaavgdnigyitfvlfprhtnasardnt
inlihtfrdylhyhikcskayihtrmraktsdflkvlnrarp

Sequence, based on observed residues (ATOM records): (download)

>d1tyqd2 d.198.2.1 (D:121-282) ARPC2 (34 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]}
fasvfekyfqfqeegkegenravihyrddetmyveskkdrvtvvfstvfkddddvvigkv
fmqefkegrrashtapqvlfshrepplegdnigyitfvlfprhtnasardntinlihtfr
dylhyhikcskayihtrmraktsdflkvlnrarp

SCOPe Domain Coordinates for d1tyqd2:

Click to download the PDB-style file with coordinates for d1tyqd2.
(The format of our PDB-style files is described here.)

Timeline for d1tyqd2: