Lineage for d1tyqd2 (1tyq D:121-282)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 615745Fold d.198: Secretion chaperone-like [69634] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 615800Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family) (S)
  5. 615801Family d.198.2.1: Arp2/3 complex subunits [69646] (2 proteins)
  6. 615802Protein ARPC2 (34 kDa subunit) [69649] (1 species)
    duplication: tandem repeat of two domains of this fold
  7. 615803Species Cow (Bos taurus) [TaxId:9913] [69650] (3 PDB entries)
  8. 615809Domain d1tyqd2: 1tyq D:121-282 [112846]
    Other proteins in same PDB: d1tyqa1, d1tyqa2, d1tyqb1, d1tyqc_, d1tyqe_, d1tyqf_, d1tyqg_
    complexed with atp, ca

Details for d1tyqd2

PDB Entry: 1tyq (more details), 2.55 Å

PDB Description: Crystal structure of Arp2/3 complex with bound ATP and calcium

SCOP Domain Sequences for d1tyqd2:

Sequence, based on SEQRES records: (download)

>d1tyqd2 d.198.2.1 (D:121-282) ARPC2 (34 kDa subunit) {Cow (Bos taurus)}
fasvfekyfqfqeegkegenravihyrddetmyveskkdrvtvvfstvfkddddvvigkv
fmqefkegrrashtapqvlfshrepplelkdtdaavgdnigyitfvlfprhtnasardnt
inlihtfrdylhyhikcskayihtrmraktsdflkvlnrarp

Sequence, based on observed residues (ATOM records): (download)

>d1tyqd2 d.198.2.1 (D:121-282) ARPC2 (34 kDa subunit) {Cow (Bos taurus)}
fasvfekyfqfqeegkegenravihyrddetmyveskkdrvtvvfstvfkddddvvigkv
fmqefkegrrashtapqvlfshrepplegdnigyitfvlfprhtnasardntinlihtfr
dylhyhikcskayihtrmraktsdflkvlnrarp

SCOP Domain Coordinates for d1tyqd2:

Click to download the PDB-style file with coordinates for d1tyqd2.
(The format of our PDB-style files is described here.)

Timeline for d1tyqd2: