SCOPe 2.08: Domain d1tyqd2: 1tyq D:121-282

Lineage for d1tyqd2 (1tyq D:121-282)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
   alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family)

5. Family d.198.2.1: Arp2/3 complex subunits [69646] (3 proteins)

6. Protein ARPC2 (34 kDa subunit) [69649] (1 species)
   duplication: tandem repeat of two domains of this fold

7. Species Cow (Bos taurus) [TaxId:9913] [69650] (16 PDB entries)
   Uniprot O15144 1-282 # 100% sequence identity

8. Domain d1tyqd2: 1tyq D:121-282 [112846]
   Other proteins in same PDB: d1tyqa1, d1tyqa2, d1tyqb1, d1tyqc_, d1tyqe_, d1tyqf_, d1tyqg_
   complexed with atp, ca

Details for d1tyqd2

PDB Entry: 1tyq, 2.55 Å

PDB Description: Crystal structure of Arp2/3 complex with bound ATP and calcium

PDB Compounds: (D:) Arp2/3 complex 34kDa subunit

SCOPe Domain Sequences for d1tyqd2:

Sequence, based on SEQRES records:

>d1tyqd2 d.198.2.1 (D:121-282) ARPC2 (34 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]}
fasvfekyfqfqeegkegenravihyrddetmyveskkdrvtvvfstvfkddddvvigkv
fmqefkegrrashtapqvlfshrepplelkdtdaavgdnigyitfvlfprhtnasardnt
inlihtfrdylhyhikcskayihtrmraktsdflkvlnrarp

Sequence, based on observed residues (ATOM records):

>d1tyqd2 d.198.2.1 (D:121-282) ARPC2 (34 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]}
fasvfekyfqfqeegkegenravihyrddetmyveskkdrvtvvfstvfkddddvvigkv
fmqefkegrrashtapqvlfshrepplegdnigyitfvlfprhtnasardntinlihtfr
dylhyhikcskayihtrmraktsdflkvlnrarp

Timeline for d1tyqd2:

• d1tyqd2 first appeared in SCOP 1.71
  
• d1tyqd2 appears in SCOPe 2.07