Lineage for d1tyqd1 (1tyq D:1-120)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 879922Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
    alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 879991Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family) (S)
  5. 879992Family d.198.2.1: Arp2/3 complex subunits [69646] (2 proteins)
  6. 879993Protein ARPC2 (34 kDa subunit) [69649] (1 species)
    duplication: tandem repeat of two domains of this fold
  7. 879994Species Cow (Bos taurus) [TaxId:9913] [69650] (10 PDB entries)
    Uniprot O15144 1-282 # 100% sequence identity
  8. 880003Domain d1tyqd1: 1tyq D:1-120 [112845]
    Other proteins in same PDB: d1tyqa1, d1tyqa2, d1tyqb1, d1tyqc_, d1tyqe_, d1tyqf_, d1tyqg_

Details for d1tyqd1

PDB Entry: 1tyq (more details), 2.55 Å

PDB Description: Crystal structure of Arp2/3 complex with bound ATP and calcium
PDB Compounds: (D:) Arp2/3 complex 34kDa subunit

SCOP Domain Sequences for d1tyqd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tyqd1 d.198.2.1 (D:1-120) ARPC2 (34 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]}
millevnnriieetlalkfenaaagnkpeavevtfadfdgvlyhisnpngdktkvmvsis
lkfykelqahgadellkrvygsylvnpesgynvsllydlenlpaskdsivhqagmlkrnc

SCOP Domain Coordinates for d1tyqd1:

Click to download the PDB-style file with coordinates for d1tyqd1.
(The format of our PDB-style files is described here.)

Timeline for d1tyqd1: