Lineage for d1tyqb1 (1tyq B:147-350)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1372365Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) (S)
    duplication contains two domains of this fold
  5. 1372366Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1372539Protein Actin-related protein 2, Arp2 [69530] (1 species)
    part of Arp2/3 complex
  7. 1372540Species Cow (Bos taurus) [TaxId:9913] [69531] (14 PDB entries)
    Uniprot P61160 143-350 # 100% sequence identity
  8. 1372545Domain d1tyqb1: 1tyq B:147-350 [112843]
    Other proteins in same PDB: d1tyqa1, d1tyqa2, d1tyqc_, d1tyqd1, d1tyqd2, d1tyqe_, d1tyqf_, d1tyqg_
    only the second half is ordered
    complexed with atp, ca

Details for d1tyqb1

PDB Entry: 1tyq (more details), 2.55 Å

PDB Description: Crystal structure of Arp2/3 complex with bound ATP and calcium
PDB Compounds: (B:) Actin-related Protein 2

SCOPe Domain Sequences for d1tyqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tyqb1 c.55.1.1 (B:147-350) Actin-related protein 2, Arp2 {Cow (Bos taurus) [TaxId: 9913]}
yaqglltgvvvdsgdgvthicpvyegfslphltrrldiagrditrylikllllrgyafnh
sadfetvrmikeklcyvgynieqeqklalettvlvesytlpdgriikvggerfeapealf
qphlinvegvgvaellfntiqaadidtrsefykhivlsggstmypglpsrlerelkqlyl
ervlkgdveklskfkiriedpprr

SCOPe Domain Coordinates for d1tyqb1:

Click to download the PDB-style file with coordinates for d1tyqb1.
(The format of our PDB-style files is described here.)

Timeline for d1tyqb1: