Lineage for d1tyef3 (1tye F:1-57)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 891088Fold g.16: Trefoil/Plexin domain-like [57491] (3 superfamilies)
    disulfide-rich fold; common core is alpha+beta with two conserved disulfides
  4. 891117Superfamily g.16.2: Plexin repeat [103575] (1 family) (S)
  5. 891118Family g.16.2.1: Plexin repeat [103576] (3 proteins)
    Pfam PF01437
  6. 891123Protein Integrin beta-3 [118249] (1 species)
  7. 891124Species Human (Homo sapiens) [TaxId:9606] [118250] (2 PDB entries)
    Uniprot P05106 27-716
    Uniprot P05106 27-466
    Uniprot P05106 27-716 ! Uniprot P05106 27-466
  8. 891127Domain d1tyef3: 1tye F:1-57 [112840]
    Other proteins in same PDB: d1tyea_, d1tyeb1, d1tyeb2, d1tyec_, d1tyed1, d1tyed2, d1tyee_, d1tyef1, d1tyef2
    complexed with ca, cac, man, mg, nag

Details for d1tyef3

PDB Entry: 1tye (more details), 2.9 Å

PDB Description: structural basis for allostery in integrins and binding of ligand- mimetic therapeutics to the platelet receptor for fibrinogen
PDB Compounds: (F:) integrin beta-3

SCOP Domain Sequences for d1tyef3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tyef3 g.16.2.1 (F:1-57) Integrin beta-3 {Human (Homo sapiens) [TaxId: 9606]}
gpnicttrgvsscqqclavspmcawcsdealplgsprcdlkenllkdncapesiefp

SCOP Domain Coordinates for d1tyef3:

Click to download the PDB-style file with coordinates for d1tyef3.
(The format of our PDB-style files is described here.)

Timeline for d1tyef3: