Lineage for d1tyef2 (1tye F:107-354)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 839328Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 839329Superfamily c.62.1: vWA-like [53300] (5 families) (S)
  5. 839330Family c.62.1.1: Integrin A (or I) domain [53301] (10 proteins)
  6. 839380Protein Integrin beta A domain [69542] (1 species)
  7. 839381Species Human (Homo sapiens) [TaxId:9606] [69543] (5 PDB entries)
    Uniprot P05106 27-716
    Uniprot P05106 27-466
    Uniprot P05106 27-716 ! Uniprot P05106 27-466
  8. 839384Domain d1tyef2: 1tye F:107-354 [112839]
    Other proteins in same PDB: d1tyea_, d1tyeb1, d1tyeb3, d1tyec_, d1tyed1, d1tyed3, d1tyee_, d1tyef1, d1tyef3
    complexed with ca, cac, man, mg, nag

Details for d1tyef2

PDB Entry: 1tye (more details), 2.9 Å

PDB Description: structural basis for allostery in integrins and binding of ligand- mimetic therapeutics to the platelet receptor for fibrinogen
PDB Compounds: (F:) integrin beta-3

SCOP Domain Sequences for d1tyef2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tyef2 c.62.1.1 (F:107-354) Integrin beta A domain {Human (Homo sapiens) [TaxId: 9606]}
vedypvdiyylmdlsysmkddlwsiqnlgtklatqmrkltsnlrigfgafvdkpvspymy
isppealenpcydmkttclpmfgykhvltltdqvtrfneevkkqsvsrnrdapeggfdai
mqatvcdekigwrndashllvfttdakthialdgrlagivqpndgqchvgsdnhysastt
mdypslglmteklsqkninlifavtenvvnlyqnyselipgttvgvlsmdssnvlqlivd
aygkirsk

SCOP Domain Coordinates for d1tyef2:

Click to download the PDB-style file with coordinates for d1tyef2.
(The format of our PDB-style files is described here.)

Timeline for d1tyef2: