Lineage for d1tyef1 (1tye F:58-106,F:355-440)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2374900Superfamily b.1.15: Integrin domains [69179] (2 families) (S)
  5. 2374901Family b.1.15.1: Integrin domains [69180] (2 proteins)
  6. 2374902Protein Hybrid domain of integrin beta [69183] (1 species)
  7. 2374903Species Human (Homo sapiens) [TaxId:9606] [69184] (9 PDB entries)
    Uniprot P05106 27-466
  8. 2374910Domain d1tyef1: 1tye F:58-106,F:355-440 [112838]
    Other proteins in same PDB: d1tyea_, d1tyeb2, d1tyeb3, d1tyec_, d1tyed2, d1tyed3, d1tyee_, d1tyef2, d1tyef3
    complexed with ca, cac, mg, nag

Details for d1tyef1

PDB Entry: 1tye (more details), 2.9 Å

PDB Description: structural basis for allostery in integrins and binding of ligand- mimetic therapeutics to the platelet receptor for fibrinogen
PDB Compounds: (F:) integrin beta-3

SCOPe Domain Sequences for d1tyef1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tyef1 b.1.15.1 (F:58-106,F:355-440) Hybrid domain of integrin beta {Human (Homo sapiens) [TaxId: 9606]}
vsearvledrplsdkgsgdssqvtqvspqrialrlrpddsknfsiqvrqXvelevrdlpe
elslsfnatclnnevipglkscmglkigdtvsfsieakvrgcpqekeksftikpvgfkds
livqvtfdcdcacqaq

SCOPe Domain Coordinates for d1tyef1:

Click to download the PDB-style file with coordinates for d1tyef1.
(The format of our PDB-style files is described here.)

Timeline for d1tyef1: