Lineage for d1tyed3 (1tye D:1-57)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2638254Fold g.16: Trefoil/Plexin domain-like [57491] (3 superfamilies)
    disulfide-rich fold; common core is alpha+beta with two conserved disulfides
  4. 2638289Superfamily g.16.2: Plexin repeat [103575] (1 family) (S)
  5. 2638290Family g.16.2.1: Plexin repeat [103576] (3 proteins)
    Pfam PF01437
  6. 2638296Protein Integrin beta-3 [118249] (1 species)
  7. 2638297Species Human (Homo sapiens) [TaxId:9606] [118250] (6 PDB entries)
    Uniprot P05106 27-716 ! Uniprot P05106 27-466
  8. 2638303Domain d1tyed3: 1tye D:1-57 [112836]
    Other proteins in same PDB: d1tyea_, d1tyeb1, d1tyeb2, d1tyec_, d1tyed1, d1tyed2, d1tyee_, d1tyef1, d1tyef2
    complexed with ca, cac, mg, nag

Details for d1tyed3

PDB Entry: 1tye (more details), 2.9 Å

PDB Description: structural basis for allostery in integrins and binding of ligand- mimetic therapeutics to the platelet receptor for fibrinogen
PDB Compounds: (D:) integrin beta-3

SCOPe Domain Sequences for d1tyed3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tyed3 g.16.2.1 (D:1-57) Integrin beta-3 {Human (Homo sapiens) [TaxId: 9606]}
gpnicttrgvsscqqclavspmcawcsdealplgsprcdlkenllkdncapesiefp

SCOPe Domain Coordinates for d1tyed3:

Click to download the PDB-style file with coordinates for d1tyed3.
(The format of our PDB-style files is described here.)

Timeline for d1tyed3: