Lineage for d1tyed2 (1tye D:107-354)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1175419Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 1175420Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 1175421Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins)
  6. 1175475Protein Integrin beta A domain [69542] (1 species)
  7. 1175476Species Human (Homo sapiens) [TaxId:9606] [69543] (5 PDB entries)
    Uniprot P05106 27-716 ! Uniprot P05106 27-466
  8. 1175478Domain d1tyed2: 1tye D:107-354 [112835]
    Other proteins in same PDB: d1tyea_, d1tyeb1, d1tyeb3, d1tyec_, d1tyed1, d1tyed3, d1tyee_, d1tyef1, d1tyef3
    complexed with ca, cac, mg, nag

Details for d1tyed2

PDB Entry: 1tye (more details), 2.9 Å

PDB Description: structural basis for allostery in integrins and binding of ligand- mimetic therapeutics to the platelet receptor for fibrinogen
PDB Compounds: (D:) integrin beta-3

SCOPe Domain Sequences for d1tyed2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tyed2 c.62.1.1 (D:107-354) Integrin beta A domain {Human (Homo sapiens) [TaxId: 9606]}
vedypvdiyylmdlsysmkddlwsiqnlgtklatqmrkltsnlrigfgafvdkpvspymy
isppealenpcydmkttclpmfgykhvltltdqvtrfneevkkqsvsrnrdapeggfdai
mqatvcdekigwrndashllvfttdakthialdgrlagivqpndgqchvgsdnhysastt
mdypslglmteklsqkninlifavtenvvnlyqnyselipgttvgvlsmdssnvlqlivd
aygkirsk

SCOPe Domain Coordinates for d1tyed2:

Click to download the PDB-style file with coordinates for d1tyed2.
(The format of our PDB-style files is described here.)

Timeline for d1tyed2: