Lineage for d1tyed1 (1tye D:58-106,D:355-440)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 937427Superfamily b.1.15: Integrin domains [69179] (1 family) (S)
  5. 937428Family b.1.15.1: Integrin domains [69180] (2 proteins)
  6. 937429Protein Hybrid domain of integrin beta [69183] (1 species)
  7. 937430Species Human (Homo sapiens) [TaxId:9606] [69184] (5 PDB entries)
    Uniprot P05106 27-466
  8. 937432Domain d1tyed1: 1tye D:58-106,D:355-440 [112834]
    Other proteins in same PDB: d1tyea_, d1tyeb2, d1tyeb3, d1tyec_, d1tyed2, d1tyed3, d1tyee_, d1tyef2, d1tyef3
    complexed with ca, cac, mg, nag

Details for d1tyed1

PDB Entry: 1tye (more details), 2.9 Å

PDB Description: structural basis for allostery in integrins and binding of ligand- mimetic therapeutics to the platelet receptor for fibrinogen
PDB Compounds: (D:) integrin beta-3

SCOPe Domain Sequences for d1tyed1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tyed1 b.1.15.1 (D:58-106,D:355-440) Hybrid domain of integrin beta {Human (Homo sapiens) [TaxId: 9606]}
vsearvledrplsdkgsgdssqvtqvspqrialrlrpddsknfsiqvrqXvelevrdlpe
elslsfnatclnnevipglkscmglkigdtvsfsieakvrgcpqekeksftikpvgfkds
livqvtfdcdcacqaq

SCOPe Domain Coordinates for d1tyed1:

Click to download the PDB-style file with coordinates for d1tyed1.
(The format of our PDB-style files is described here.)

Timeline for d1tyed1: