| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.15: Integrin domains [69179] (1 family) ![]() |
| Family b.1.15.1: Integrin domains [69180] (2 proteins) |
| Protein Hybrid domain of integrin beta [69183] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [69184] (5 PDB entries) Uniprot P05106 27-466 |
| Domain d1tyed1: 1tye D:58-106,D:355-440 [112834] Other proteins in same PDB: d1tyea_, d1tyeb2, d1tyeb3, d1tyec_, d1tyed2, d1tyed3, d1tyee_, d1tyef2, d1tyef3 |
PDB Entry: 1tye (more details), 2.9 Å
SCOP Domain Sequences for d1tyed1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tyed1 b.1.15.1 (D:58-106,D:355-440) Hybrid domain of integrin beta {Human (Homo sapiens) [TaxId: 9606]}
vsearvledrplsdkgsgdssqvtqvspqrialrlrpddsknfsiqvrqXvelevrdlpe
elslsfnatclnnevipglkscmglkigdtvsfsieakvrgcpqekeksftikpvgfkds
livqvtfdcdcacqaq
Timeline for d1tyed1: