Class g: Small proteins [56992] (90 folds) |
Fold g.16: Trefoil/Plexin domain-like [57491] (3 superfamilies) disulfide-rich fold; common core is alpha+beta with two conserved disulfides |
Superfamily g.16.2: Plexin repeat [103575] (1 family) |
Family g.16.2.1: Plexin repeat [103576] (3 proteins) Pfam PF01437 |
Protein Integrin beta-3 [118249] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [118250] (2 PDB entries) Uniprot P05106 27-716 ! Uniprot P05106 27-466 |
Domain d1tyeb3: 1tye B:1-57 [112832] Other proteins in same PDB: d1tyea_, d1tyeb1, d1tyeb2, d1tyec_, d1tyed1, d1tyed2, d1tyee_, d1tyef1, d1tyef2 complexed with ca, cac, mg, nag |
PDB Entry: 1tye (more details), 2.9 Å
SCOPe Domain Sequences for d1tyeb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tyeb3 g.16.2.1 (B:1-57) Integrin beta-3 {Human (Homo sapiens) [TaxId: 9606]} gpnicttrgvsscqqclavspmcawcsdealplgsprcdlkenllkdncapesiefp
Timeline for d1tyeb3: