Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.15: Integrin domains [69179] (2 families) |
Family b.1.15.1: Integrin domains [69180] (2 proteins) |
Protein Hybrid domain of integrin beta [69183] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [69184] (9 PDB entries) Uniprot P05106 27-466 |
Domain d1tyeb1: 1tye B:58-106,B:355-440 [112830] Other proteins in same PDB: d1tyea_, d1tyeb2, d1tyeb3, d1tyec_, d1tyed2, d1tyed3, d1tyee_, d1tyef2, d1tyef3 complexed with ca, cac, mg, nag |
PDB Entry: 1tye (more details), 2.9 Å
SCOPe Domain Sequences for d1tyeb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tyeb1 b.1.15.1 (B:58-106,B:355-440) Hybrid domain of integrin beta {Human (Homo sapiens) [TaxId: 9606]} vsearvledrplsdkgsgdssqvtqvspqrialrlrpddsknfsiqvrqXvelevrdlpe elslsfnatclnnevipglkscmglkigdtvsfsieakvrgcpqekeksftikpvgfkds livqvtfdcdcacqaq
Timeline for d1tyeb1: