Lineage for d1tyea_ (1tye A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1135268Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 1135580Superfamily b.69.8: Integrin alpha N-terminal domain [69318] (1 family) (S)
  5. 1135581Family b.69.8.1: Integrin alpha N-terminal domain [69319] (1 protein)
  6. 1135582Protein Integrin alpha N-terminal domain [69320] (2 species)
  7. 1135583Species Human (Homo sapiens), isoform IIb [TaxId:9606] [117285] (15 PDB entries)
    Uniprot P08514 32-483
  8. 1135603Domain d1tyea_: 1tye A: [112829]
    Other proteins in same PDB: d1tyeb1, d1tyeb2, d1tyeb3, d1tyed1, d1tyed2, d1tyed3, d1tyef1, d1tyef2, d1tyef3
    complexed with ca, cac, mg, nag

Details for d1tyea_

PDB Entry: 1tye (more details), 2.9 Å

PDB Description: structural basis for allostery in integrins and binding of ligand- mimetic therapeutics to the platelet receptor for fibrinogen
PDB Compounds: (A:) integrin alpha-IIb

SCOPe Domain Sequences for d1tyea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tyea_ b.69.8.1 (A:) Integrin alpha N-terminal domain {Human (Homo sapiens), isoform IIb [TaxId: 9606]}
lnldpvqltfyagpngsqfgfsldfhkdshgrvaivvgaprtlgpsqeetggvflcpwra
eggqcpsllfdlrdetrnvgsqtlqtfkarqglgasvvswsdvivacapwqhwnvlekte
eaektpvgscflaqpesgrraeyspcrgntlsriyvendfswdkryceagfssvvtqage
lvlgapggyyflgllaqapvadifssyrpgillwhvssqslsfdssnpeyfdgywgysva
vgefdgdlntteyvvgaptwswtlgaveildsyyqrlhrlraeqmasyfghsvavtdvng
dgrhdllvgaplymesradrklaevgrvylflqprgphalgapsllltgtqlygrfgsai
aplgdldrdgyndiavaapyggpsgrgqvlvflgqseglrsrpsqvldspfptgsafgfs
lrgavdiddngypdlivgayganqvavyraqp

SCOPe Domain Coordinates for d1tyea_:

Click to download the PDB-style file with coordinates for d1tyea_.
(The format of our PDB-style files is described here.)

Timeline for d1tyea_: