SCOP 1.73: Domain d1ty9b_: 1ty9 B:

Lineage for d1ty9b_ (1ty9 B:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.45: Split barrel-like [50474] (2 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (3 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.1: PNP-oxidase like [50476] (16 proteins)

6. Protein Pyridoxine 5'-phoshate oxidase (PNP oxidase) [50479] (6 species)
   elaborated with additional secondary structures; active as dimer

7. Species Pseudomonas fluorescens [TaxId:294] [117227] (1 PDB entry)

8. Domain d1ty9b_: 1ty9 B: [112828]
   complexed with fmn, so4

Details for d1ty9b_

PDB Entry: 1ty9, 1.8 Å

PDB Description: x-ray crystal structure of phzg from pseudomonas fluorescens

PDB Compounds: (B:) Phenazine biosynthesis protein phzG

SCOP Domain Sequences for d1ty9b_:

Sequence; same for both SEQRES and ATOM records:

>d1ty9b_ b.45.1.1 (B:) Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Pseudomonas fluorescens [TaxId: 294]}
sesltgtldapfpeyqtlpadpmsvlhnwlerarrvgirepralalatadsqgrpstriv
viseisdagvvfsthagsqkgrellhnpwasgvlywretsqqiilngqavrlpnakadda
wlkrpyathpmssvsrqseelqdvqamrnaarqlaelqgplprpegycvfelrleslefw
gngqerlherlrydrsdtgwnvrrlqp

Timeline for d1ty9b_:

• d1ty9b_ first appeared in SCOP 1.71
  
• d1ty9b_ appears in SCOP 1.75
  
• d1ty9b_ appears in the current release, SCOPe 2.08