Lineage for d1ty9b_ (1ty9 B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 561372Fold b.45: FMN-binding split barrel [50474] (1 superfamily)
    barrel; n=6, S=10; greek-key
  4. 561373Superfamily b.45.1: FMN-binding split barrel [50475] (2 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 561374Family b.45.1.1: PNP-oxidase like [50476] (6 proteins)
  6. 561398Protein Pyridoxine 5'-phoshate oxidase (PNP oxidase) [50479] (5 species)
    elaborated with additional secondary structures; active as dimer
  7. 561416Species Pseudomonas fluorescens [TaxId:294] [117227] (1 PDB entry)
  8. 561418Domain d1ty9b_: 1ty9 B: [112828]
    complexed with fmn, so4

Details for d1ty9b_

PDB Entry: 1ty9 (more details), 1.8 Å

PDB Description: x-ray crystal structure of phzg from pseudomonas fluorescens

SCOP Domain Sequences for d1ty9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ty9b_ b.45.1.1 (B:) Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Pseudomonas fluorescens}
sesltgtldapfpeyqtlpadpmsvlhnwlerarrvgirepralalatadsqgrpstriv
viseisdagvvfsthagsqkgrellhnpwasgvlywretsqqiilngqavrlpnakadda
wlkrpyathpmssvsrqseelqdvqamrnaarqlaelqgplprpegycvfelrleslefw
gngqerlherlrydrsdtgwnvrrlqp

SCOP Domain Coordinates for d1ty9b_:

Click to download the PDB-style file with coordinates for d1ty9b_.
(The format of our PDB-style files is described here.)

Timeline for d1ty9b_: