Lineage for d1ty9a_ (1ty9 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1792693Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 1792694Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 1792695Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)
  6. 1792778Protein Pyridoxine 5'-phoshate oxidase (PNP oxidase) [50479] (6 species)
    elaborated with additional secondary structures; active as dimer
  7. 1792799Species Pseudomonas fluorescens [TaxId:294] [117227] (5 PDB entries)
    Uniprot Q51793
  8. 1792808Domain d1ty9a_: 1ty9 A: [112827]
    complexed with fmn, so4

Details for d1ty9a_

PDB Entry: 1ty9 (more details), 1.8 Å

PDB Description: x-ray crystal structure of phzg from pseudomonas fluorescens
PDB Compounds: (A:) Phenazine biosynthesis protein phzG

SCOPe Domain Sequences for d1ty9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ty9a_ b.45.1.1 (A:) Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Pseudomonas fluorescens [TaxId: 294]}
gtldapfpeyqtlpadpmsvlhnwlerarrvgirepralalatadsqgrpstrivvisei
sdagvvfsthagsqkgrellhnpwasgvlywretsqqiilngqavrlpnakaddawlkrp
yathpmssvsrqseelqdvqamrnaarqlaelqgplprpegycvfelrleslefwgngqe
rlherlrydrsdtgwnvrrlqp

SCOPe Domain Coordinates for d1ty9a_:

Click to download the PDB-style file with coordinates for d1ty9a_.
(The format of our PDB-style files is described here.)

Timeline for d1ty9a_: