Lineage for d1ty8a_ (1ty8 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2120592Fold c.50: Macro domain-like [52948] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest
  4. 2120593Superfamily c.50.1: Macro domain-like [52949] (4 families) (S)
  5. 2120618Family c.50.1.2: Macro domain [89724] (7 protein domains)
    found in different proteins, including macro-H2a histone and the Appr-1"-p processing enzyme
  6. 2120653Protein Hypothetical protein Ymr087W [110654] (1 species)
    contains structural variations at both termini
  7. 2120654Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110655] (3 PDB entries)
    Uniprot Q04299
  8. 2120657Domain d1ty8a_: 1ty8 A: [112826]
    complexed with adp, cl, na

Details for d1ty8a_

PDB Entry: 1ty8 (more details), 2.1 Å

PDB Description: crystal structure of yeast ymx7, an adp-ribose-1''-monophosphatase, complexed with adp
PDB Compounds: (A:) Hypothetical 32.1 kDa protein in ADH3-RCA1 intergenic region

SCOPe Domain Sequences for d1ty8a_:

Sequence, based on SEQRES records: (download)

>d1ty8a_ c.50.1.2 (A:) Hypothetical protein Ymr087W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kmriilcdtnevvtnlwqesiphayiqndkylcihhghlqslmdsmrkgdaihhghsyai
vspgnsygylgggfdkalynyfggkpfetwfrnqlggryhtvgsatvvdlqrcleektie
crdgiryiihvptvvapsapifnpqnplktgfepvfnamwnalmhspkdidgliipglct
gyagvppiiscksmafalrlymagdhiskelknvlimyylqypfepffpesckiecqklg
idiemlksfnvekdaielliprri

Sequence, based on observed residues (ATOM records): (download)

>d1ty8a_ c.50.1.2 (A:) Hypothetical protein Ymr087W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kmriilcdtnevvtnlwqesipkylcihhghlqslmdsmrkgdahsyaivspgnsygylg
ggfdkalynyfggkpfetwfrnqlggryhtvgsatvvdlqrcleecrdgiryiihvptvv
apsapifnpqnplktgfepvfnamwnalmhspkdidgliipglctgyagvppiiscksma
falrlymagdhiskelknvlimyylqypfepffpesckiecqklgidiemlksfnvekda
ielliprri

SCOPe Domain Coordinates for d1ty8a_:

Click to download the PDB-style file with coordinates for d1ty8a_.
(The format of our PDB-style files is described here.)

Timeline for d1ty8a_: