SCOP 1.73: Domain d1ty7l1: 1ty7 L:1-107

Lineage for d1ty7l1 (1ty7 L:1-107)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (181 PDB entries)

8. Domain d1ty7l1: 1ty7 L:1-107 [112824]
   Other proteins in same PDB: d1ty7a_, d1ty7b1, d1ty7b2, d1ty7b3, d1ty7h1, d1ty7h2, d1ty7l2
   complexed with 180, ca, gol, man, mg, nag

Details for d1ty7l1

PDB Entry: 1ty7, 3.1 Å

PDB Description: Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen

PDB Compounds: (L:) monoclonal antibody 10e5 light chain

SCOP Domain Sequences for d1ty7l1:

Sequence; same for both SEQRES and ATOM records:

>d1ty7l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
dilmtqspssmsvslgdtvsitchasqgissnigwlqqkpgksfmgliyygtnlvdgvps
rfsgsgsgadysltissldsedfadyycvqyaqlpytfgggtkleik

Timeline for d1ty7l1:

• d1ty7l1 first appeared in SCOP 1.71
  
• d1ty7l1 does not appear in SCOP 1.75