Lineage for d1txnb_ (1txn B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008710Fold d.248: Coproporphyrinogen III oxidase [102885] (2 superfamilies)
    alpha-beta(6)-alpha(2)-beta-alpha(n); 3 layers alpha/beta/alpha; antiparallel sheet: order 1234567
  4. 3008711Superfamily d.248.1: Coproporphyrinogen III oxidase [102886] (2 families) (S)
    automatically mapped to Pfam PF01218
  5. 3008712Family d.248.1.1: Coproporphyrinogen III oxidase [102887] (3 proteins)
    Pfam PF01218
  6. 3008713Protein Coproporphyrinogen III oxidase [110896] (1 species)
  7. 3008714Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110897] (4 PDB entries)
    Uniprot P11353
  8. 3008724Domain d1txnb_: 1txn B: [112780]
    Structural genomics target; C-terminal part is disordered in the crystal; alternative dimerisation mode (cf. 1TK1)
    complexed with gol

Details for d1txnb_

PDB Entry: 1txn (more details), 1.7 Å

PDB Description: crystal structure of coproporphyrinogen iii oxidase
PDB Compounds: (B:) Coproporphyrinogen III oxidase

SCOPe Domain Sequences for d1txnb_:

Sequence, based on SEQRES records: (download)

>d1txnb_ d.248.1.1 (B:) Coproporphyrinogen III oxidase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
papqdprnlpirqqmealirrkqaeitqglesidtvkfhadtwtrgndggggtsmviqdg
ttfekggvnvsvvygqlspaavsamkadhknlrlpedpktglpvtdgvkffacglsmvih
pvnphaptthlnyryfetwnqdgtpqtwwfgggadltpsylyeedgqlfhqlhkdaldkh
dtalyprfkkwcdeyfyithrketrgiggiffddyderdpqeilkmvedcfdaflpsylt
ivkrrkdmpytkeeqqwqairrgryvefn

Sequence, based on observed residues (ATOM records): (download)

>d1txnb_ d.248.1.1 (B:) Coproporphyrinogen III oxidase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
papqdprnlpirqqmealirrkqaeitqglesidtvkfhadtwtrgndggggtsmviqdg
ttfekggvnvsvvygqlspaavsamkadhknlrlpdgvkffacglsmvihpvnphaptth
lnyryfetwnqdgtpqtwwfgggadltpsylyeedgqlfhqlhkdaldkhdtalyprfkk
wcdeyfyithrrgiggiffddyderdpqeilkmvedcfdaflpsyltivkrrkdmpytke
eqqwqairrgryvefn

SCOPe Domain Coordinates for d1txnb_:

Click to download the PDB-style file with coordinates for d1txnb_.
(The format of our PDB-style files is described here.)

Timeline for d1txnb_: