SCOPe 2.07: Domain d1txgb2: 1txg B:1-180

Lineage for d1txgb2 (1txg B:1-180)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins)
   the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
   C-terminal domains also show some similarity

6. Protein Glycerol-3- phosphate dehydrogenase [51881] (2 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [117433] (1 PDB entry)
   Uniprot O29390

8. Domain d1txgb2: 1txg B:1-180 [112778]
   Other proteins in same PDB: d1txga1, d1txgb1
   complexed with gol, nh4, so4

Details for d1txgb2

PDB Entry: 1txg, 1.7 Å

PDB Description: Structure of glycerol-3-phosphate dehydrogenase from Archaeoglobus fulgidus

PDB Compounds: (B:) glycerol-3-phosphate dehydrogenase [NAD(P)+]

SCOPe Domain Sequences for d1txgb2:

Sequence; same for both SEQRES and ATOM records:

>d1txgb2 c.2.1.6 (B:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]}
mivsilgagamgsalsvplvdngnevriwgtefdteilksisagrehprlgvklngveif
wpeqlekclenaevvllgvstdgvlpvmsrilpylkdqyivliskglidfdnsvltvpea
vwrlkhdlrertvaitgpaiarevakrmpttvvfsspsessankmkeifeteyfgvevtt

Timeline for d1txgb2:

• d1txgb2 first appeared in SCOP 1.71
  
• d1txgb2 appears in SCOPe 2.06
  
• d1txgb2 appears in the current release, SCOPe 2.08