Lineage for d1txgb2 (1txg B:1-180)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844998Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins)
    the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
    C-terminal domains also show some similarity
  6. 2845067Protein Glycerol-3- phosphate dehydrogenase [51881] (2 species)
  7. 2845068Species Archaeoglobus fulgidus [TaxId:2234] [117433] (1 PDB entry)
    Uniprot O29390
  8. 2845070Domain d1txgb2: 1txg B:1-180 [112778]
    Other proteins in same PDB: d1txga1, d1txgb1
    complexed with gol, nh4, so4

Details for d1txgb2

PDB Entry: 1txg (more details), 1.7 Å

PDB Description: Structure of glycerol-3-phosphate dehydrogenase from Archaeoglobus fulgidus
PDB Compounds: (B:) glycerol-3-phosphate dehydrogenase [NAD(P)+]

SCOPe Domain Sequences for d1txgb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1txgb2 c.2.1.6 (B:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]}
mivsilgagamgsalsvplvdngnevriwgtefdteilksisagrehprlgvklngveif
wpeqlekclenaevvllgvstdgvlpvmsrilpylkdqyivliskglidfdnsvltvpea
vwrlkhdlrertvaitgpaiarevakrmpttvvfsspsessankmkeifeteyfgvevtt

SCOPe Domain Coordinates for d1txgb2:

Click to download the PDB-style file with coordinates for d1txgb2.
(The format of our PDB-style files is described here.)

Timeline for d1txgb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1txgb1