Lineage for d1txgb1 (1txg B:181-335)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 645590Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 645591Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (12 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 645702Family a.100.1.6: Glycerol-3-phosphate dehydrogenase [48197] (1 protein)
  6. 645703Protein Glycerol-3-phosphate dehydrogenase [48198] (2 species)
  7. 645704Species Archaeoglobus fulgidus [TaxId:2234] [116983] (1 PDB entry)
  8. 645706Domain d1txgb1: 1txg B:181-335 [112777]
    Other proteins in same PDB: d1txga2, d1txgb2
    complexed with gol, nh4, so4

Details for d1txgb1

PDB Entry: 1txg (more details), 1.7 Å

PDB Description: Structure of glycerol-3-phosphate dehydrogenase from Archaeoglobus fulgidus
PDB Compounds: (B:) glycerol-3-phosphate dehydrogenase [NAD(P)+]

SCOP Domain Sequences for d1txgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1txgb1 a.100.1.6 (B:181-335) Glycerol-3-phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]}
diigteitsalknvysiaiawirgyesrknvemsnakgviatrainemaelieilggdre
tafglsgfgdliatfrggrngmlgellgkglsideameelerrgvgvvegyktaekayrl
sskinadtklldsiyrvlyeglkveevlfelatfk

SCOP Domain Coordinates for d1txgb1:

Click to download the PDB-style file with coordinates for d1txgb1.
(The format of our PDB-style files is described here.)

Timeline for d1txgb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1txgb2