Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) |
Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (15 proteins) the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest C-terminal domains also show some similarity |
Protein Glycerol-3- phosphate dehydrogenase [51881] (2 species) |
Species Archaeoglobus fulgidus [TaxId:2234] [117433] (1 PDB entry) |
Domain d1txga2: 1txg A:1-180 [112776] Other proteins in same PDB: d1txga1, d1txgb1 |
PDB Entry: 1txg (more details), 1.7 Å
SCOP Domain Sequences for d1txga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus} mivsilgagamgsalsvplvdngnevriwgtefdteilksisagrehprlgvklngveif wpeqlekclenaevvllgvstdgvlpvmsrilpylkdqyivliskglidfdnsvltvpea vwrlkhdlrertvaitgpaiarevakrmpttvvfsspsessankmkeifeteyfgvevtt
Timeline for d1txga2: