Lineage for d1twyh_ (1twy H:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 846191Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 846192Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 846193Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins)
  6. 846194Protein ABC transporter, periplasmic substrate-binding protein VCA0807 [117747] (1 species)
  7. 846195Species Vibrio cholerae [TaxId:666] [117748] (1 PDB entry)
    Uniprot Q9KLD9 26-274
  8. 846203Domain d1twyh_: 1twy H: [112774]
    Structural genomics target
    complexed with mg, po4

Details for d1twyh_

PDB Entry: 1twy (more details), 1.65 Å

PDB Description: crystal structure of an abc-type phosphate transport receptor from vibrio cholerae
PDB Compounds: (H:) ABC transporter, periplasmic substrate-binding protein

SCOP Domain Sequences for d1twyh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1twyh_ c.94.1.1 (H:) ABC transporter, periplasmic substrate-binding protein VCA0807 {Vibrio cholerae [TaxId: 666]}
seitisgstsvarimdvlaekynqqhpetyvavqgvgstagisllkkgvadiamtsrylt
eseaqntlhtftlafdglaivvnqanpvtnltreqlygiykgqitnwkqvggndqkiavv
treassgtrysfeslmgltktvkdrevsdvaptalvvnsnsmmktlvnhntqavgfisig
svdksvkaiqfekadptsdniakhtyqlsrpflilhysdnadeqtkefiaflksesakkl
iveygyimp

SCOP Domain Coordinates for d1twyh_:

Click to download the PDB-style file with coordinates for d1twyh_.
(The format of our PDB-style files is described here.)

Timeline for d1twyh_: