Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) |
Protein ABC transporter, periplasmic substrate-binding protein VCA0807 [117747] (1 species) |
Species Vibrio cholerae [TaxId:666] [117748] (1 PDB entry) Uniprot Q9KLD9 26-274 |
Domain d1twyd_: 1twy D: [112770] Structural genomics target complexed with mg, po4 |
PDB Entry: 1twy (more details), 1.65 Å
SCOPe Domain Sequences for d1twyd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1twyd_ c.94.1.1 (D:) ABC transporter, periplasmic substrate-binding protein VCA0807 {Vibrio cholerae [TaxId: 666]} seitisgstsvarimdvlaekynqqhpetyvavqgvgstagisllkkgvadiamtsrylt eseaqntlhtftlafdglaivvnqanpvtnltreqlygiykgqitnwkqvggndqkiavv treassgtrysfeslmgltktvkdrevsdvaptalvvnsnsmmktlvnhntqavgfisig svdksvkaiqfekadptsdniakhtyqlsrpflilhysdnadeqtkefiaflksesakkl iveygyimp
Timeline for d1twyd_: