Lineage for d1twya_ (1twy A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2913610Protein ABC transporter, periplasmic substrate-binding protein VCA0807 [117747] (1 species)
  7. 2913611Species Vibrio cholerae [TaxId:666] [117748] (1 PDB entry)
    Uniprot Q9KLD9 26-274
  8. 2913612Domain d1twya_: 1twy A: [112767]
    Structural genomics target
    complexed with mg, po4

Details for d1twya_

PDB Entry: 1twy (more details), 1.65 Å

PDB Description: crystal structure of an abc-type phosphate transport receptor from vibrio cholerae
PDB Compounds: (A:) ABC transporter, periplasmic substrate-binding protein

SCOPe Domain Sequences for d1twya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1twya_ c.94.1.1 (A:) ABC transporter, periplasmic substrate-binding protein VCA0807 {Vibrio cholerae [TaxId: 666]}
seitisgstsvarimdvlaekynqqhpetyvavqgvgstagisllkkgvadiamtsrylt
eseaqntlhtftlafdglaivvnqanpvtnltreqlygiykgqitnwkqvggndqkiavv
treassgtrysfeslmgltktvkdrevsdvaptalvvnsnsmmktlvnhntqavgfisig
svdksvkaiqfekadptsdniakhtyqlsrpflilhysdnadeqtkefiaflksesakkl
iveygyimp

SCOPe Domain Coordinates for d1twya_:

Click to download the PDB-style file with coordinates for d1twya_.
(The format of our PDB-style files is described here.)

Timeline for d1twya_: