Lineage for d1twqa_ (1twq A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 610138Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
    contains mixed beta-sheet
  4. 610139Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (1 family) (S)
  5. 610140Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (5 proteins)
    Family 2 zinc amidase;
  6. 610148Protein Peptidoglycan recognition protein I-alpha [111141] (1 species)
  7. 610149Species Human (Homo sapiens) [TaxId:9606] [111142] (3 PDB entries)
  8. 610151Domain d1twqa_: 1twq A: [112766]
    complexed with amu, nh2, ni

Details for d1twqa_

PDB Entry: 1twq (more details), 2.3 Å

PDB Description: crystal structure of the c-terminal pgn-binding domain of human pgrp- ialpha in complex with pgn analog muramyl tripeptide

SCOP Domain Sequences for d1twqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1twqa_ d.118.1.1 (A:) Peptidoglycan recognition protein I-alpha {Human (Homo sapiens)}
vcpniikrsawearethcpkmnlpakyviiihtagtsctvstdcqtvvrniqsfhmdtrn
fcdigyhflvgqdggvyegvgwhiqgshtygfndialgiafigyfvekppnaaaleaaqd
liqcavvegyltpnyllmghsdvvnilspgqalyniistwphfkh

SCOP Domain Coordinates for d1twqa_:

Click to download the PDB-style file with coordinates for d1twqa_.
(The format of our PDB-style files is described here.)

Timeline for d1twqa_: