| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily) contains mixed beta-sheet |
Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) ![]() |
| Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins) Family 2 zinc amidase; |
| Protein Peptidoglycan recognition protein I-alpha [111141] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [111142] (4 PDB entries) Uniprot Q96LB9 177-341 |
| Domain d1twqa_: 1twq A: [112766] complexed with ni |
PDB Entry: 1twq (more details), 2.3 Å
SCOPe Domain Sequences for d1twqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1twqa_ d.118.1.1 (A:) Peptidoglycan recognition protein I-alpha {Human (Homo sapiens) [TaxId: 9606]}
vcpniikrsawearethcpkmnlpakyviiihtagtsctvstdcqtvvrniqsfhmdtrn
fcdigyhflvgqdggvyegvgwhiqgshtygfndialgiafigyfvekppnaaaleaaqd
liqcavvegyltpnyllmghsdvvnilspgqalyniistwphfkh
Timeline for d1twqa_: