Lineage for d1twma_ (1twm A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 560566Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 560567Superfamily b.42.1: Cytokine [50353] (2 families) (S)
  5. 560703Family b.42.1.2: Interleukin-1 (IL-1) [50362] (5 proteins)
  6. 560720Protein Interleukin-1beta [50363] (2 species)
  7. 560721Species Human (Homo sapiens) [TaxId:9606] [50364] (19 PDB entries)
  8. 560730Domain d1twma_: 1twm A: [112765]
    mutant

Details for d1twma_

PDB Entry: 1twm (more details), 2.26 Å

PDB Description: Interleukin-1 Beta Mutant F146Y

SCOP Domain Sequences for d1twma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1twma_ b.42.1.2 (A:) Interleukin-1beta {Human (Homo sapiens)}
apvrslnctlrdsqqkslvmsgpyelkalhlqgqdmeqqvvfsmsfvqgeesndkipval
glkeknlylscvlkddkptlqlesvdpknypkkkmekrfvfnkieinnklefesaqfpnw
yistsqaenmpvflggtkggqditdytmqfvss

SCOP Domain Coordinates for d1twma_:

Click to download the PDB-style file with coordinates for d1twma_.
(The format of our PDB-style files is described here.)

Timeline for d1twma_: