Lineage for d1twma_ (1twm A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2791606Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2791924Family b.42.1.2: Interleukin-1 (IL-1) [50362] (6 proteins)
  6. 2791952Protein Interleukin-1beta [50363] (2 species)
  7. 2791953Species Human (Homo sapiens) [TaxId:9606] [50364] (53 PDB entries)
    Uniprot P01584 117-269
  8. 2791986Domain d1twma_: 1twm A: [112765]
    mutant

Details for d1twma_

PDB Entry: 1twm (more details), 2.26 Å

PDB Description: interleukin-1 beta mutant f146y
PDB Compounds: (A:) interleukin-1 beta

SCOPe Domain Sequences for d1twma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1twma_ b.42.1.2 (A:) Interleukin-1beta {Human (Homo sapiens) [TaxId: 9606]}
apvrslnctlrdsqqkslvmsgpyelkalhlqgqdmeqqvvfsmsfvqgeesndkipval
glkeknlylscvlkddkptlqlesvdpknypkkkmekrfvfnkieinnklefesaqfpnw
yistsqaenmpvflggtkggqditdytmqfvss

SCOPe Domain Coordinates for d1twma_:

Click to download the PDB-style file with coordinates for d1twma_.
(The format of our PDB-style files is described here.)

Timeline for d1twma_: