Lineage for d1twla_ (1twl A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2790734Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 2790735Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 proteins)
    barrel, closed; n=5, S=8
  6. 2790736Protein Inorganic pyrophosphatase [50326] (9 species)
    eukaryotic enzyme has additional secondary structures at both N- and C-termini
  7. 2790813Species Pyrococcus furiosus [TaxId:2261] [117207] (1 PDB entry)
    Uniprot Q8U438
  8. 2790814Domain d1twla_: 1twl A: [112764]

Details for d1twla_

PDB Entry: 1twl (more details), 2.2 Å

PDB Description: inorganic pyrophosphatase from pyrococcus furiosus pfu-264096-001
PDB Compounds: (A:) inorganic pyrophosphatase

SCOPe Domain Sequences for d1twla_:

Sequence, based on SEQRES records: (download)

>d1twla_ b.40.5.1 (A:) Inorganic pyrophosphatase {Pyrococcus furiosus [TaxId: 2261]}
npfhdlepgpdvpevvyaiieipkgsrnkyeldkktgllkldrvlyspffypvdygiipr
twyedddpfdimvimrepvypltiiearpiglfkmidsgdkdykvlavpvedpyfkdwkd
iddvpkafldeiahffkrykelqgkeiivegwegaeaakreilraiemykekf

Sequence, based on observed residues (ATOM records): (download)

>d1twla_ b.40.5.1 (A:) Inorganic pyrophosphatase {Pyrococcus furiosus [TaxId: 2261]}
npfhdlepgpdvpevvyaiieipkgsrnkyeldkktgllkldrvlyspffypvdygiipr
twyeddpfdimvimrepvypltiiearpiglfkmidsgdkdykvlavpvedpyfkdwkdi
ddvpkafldeiahffkrykelqgkeiivegwegaeaakreilraiemykekf

SCOPe Domain Coordinates for d1twla_:

Click to download the PDB-style file with coordinates for d1twla_.
(The format of our PDB-style files is described here.)

Timeline for d1twla_: