SCOP 1.73: Domain d1twhj_: 1twh J:

Lineage for d1twhj_ (1twh J:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family)

5. Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (1 protein)
   Zn-binding site is near the N-terminus

6. Protein RNA polymerase subunit RPB10 [46926] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63490] (24 PDB entries)

8. Domain d1twhj_: 1twh J: [112761]
   Other proteins in same PDB: d1twha_, d1twhb_, d1twhc1, d1twhc2, d1twhe1, d1twhe2, d1twhf_, d1twhh_, d1twhi1, d1twhi2, d1twhk_, d1twhl_
   complexed with atp, mn, zn

Details for d1twhj_

PDB Entry: 1twh, 3.4 Å

PDB Description: RNA polymerase II complexed with 2'dATP

PDB Compounds: (J:) DNA-directed RNA polymerases I, II, and III 8.3 kDa polypeptide

SCOP Domain Sequences for d1twhj_:

Sequence; same for both SEQRES and ATOM records:

>d1twhj_ a.4.11.1 (J:) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lryn

Timeline for d1twhj_:

• d1twhj_ first appeared in SCOP 1.71
  
• d1twhj_ appears in SCOP 1.75
  
• d1twhj_ appears in the current release, SCOPe 2.08