SCOP 1.73: Domain d1twhi2: 1twh I:50-121

Lineage for d1twhi2 (1twh I:50-121)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.3: Zinc beta-ribbon [57783] (5 families)

5. Family g.41.3.1: Transcriptional factor domain [57784] (4 proteins)

6. Protein RBP9 subunit of RNA polymerase II [57787] (2 species)
   contains two differently decorated domains of this fold

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (24 PDB entries)

8. Domain d1twhi2: 1twh I:50-121 [112760]
   Other proteins in same PDB: d1twha_, d1twhb_, d1twhc1, d1twhc2, d1twhe1, d1twhe2, d1twhf_, d1twhh_, d1twhj_, d1twhk_, d1twhl_
   complexed with atp, mn, zn

Details for d1twhi2

PDB Entry: 1twh, 3.4 Å

PDB Description: RNA polymerase II complexed with 2'dATP

PDB Compounds: (I:) DNA-directed RNA polymerase II 14.2 kDa polypeptide

SCOP Domain Sequences for d1twhi2:

Sequence; same for both SEQRES and ATOM records:

>d1twhi2 g.41.3.1 (I:50-121) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tnigetagvvqdigsdptlprsdrecpkchsrenvffqsqqrrkdtsmvlffvclscshi
ftsdqknkrtqf

Timeline for d1twhi2:

• d1twhi2 first appeared in SCOP 1.71
  
• d1twhi2 appears in SCOP 1.75
  
• d1twhi2 appears in the current release, SCOPe 2.08