Lineage for d1twhf_ (1twh F:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 649980Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 649981Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 650007Family a.143.1.2: RPB6 [55294] (1 protein)
  6. 650008Protein RPB6 [55295] (2 species)
    essential subunit of RNA polymerases I, II and III
  7. 650009Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (24 PDB entries)
  8. 650017Domain d1twhf_: 1twh F: [112757]
    Other proteins in same PDB: d1twha_, d1twhb_, d1twhc1, d1twhc2, d1twhe1, d1twhe2, d1twhh_, d1twhi1, d1twhi2, d1twhj_, d1twhk_, d1twhl_
    complexed with atp, mn, zn

Details for d1twhf_

PDB Entry: 1twh (more details), 3.4 Å

PDB Description: RNA polymerase II complexed with 2'dATP
PDB Compounds: (F:) DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide

SCOP Domain Sequences for d1twhf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1twhf_ a.143.1.2 (F:) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
lvirrylpdgsfedwsveelivd

SCOP Domain Coordinates for d1twhf_:

Click to download the PDB-style file with coordinates for d1twhf_.
(The format of our PDB-style files is described here.)

Timeline for d1twhf_: