Lineage for d1twhe1 (1twh E:1-143)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 700831Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 701191Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family) (S)
  5. 701192Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (1 protein)
  6. 701193Protein Eukaryotic RPB5 N-terminal domain [53038] (1 species)
  7. 701194Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53039] (25 PDB entries)
  8. 701203Domain d1twhe1: 1twh E:1-143 [112755]
    Other proteins in same PDB: d1twha_, d1twhb_, d1twhc1, d1twhc2, d1twhe2, d1twhf_, d1twhh_, d1twhi1, d1twhi2, d1twhj_, d1twhk_, d1twhl_
    complexed with atp, mn, zn

Details for d1twhe1

PDB Entry: 1twh (more details), 3.4 Å

PDB Description: RNA polymerase II complexed with 2'dATP
PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide

SCOP Domain Sequences for d1twhe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1twhe1 c.52.3.1 (E:1-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsf
qanpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsa
mklvpsippatietfneaalvvn

SCOP Domain Coordinates for d1twhe1:

Click to download the PDB-style file with coordinates for d1twhe1.
(The format of our PDB-style files is described here.)

Timeline for d1twhe1: