| Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
| Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family) ![]() |
| Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (1 protein) |
| Protein Eukaryotic RPB5 N-terminal domain [53038] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53039] (25 PDB entries) |
| Domain d1twhe1: 1twh E:1-143 [112755] Other proteins in same PDB: d1twha_, d1twhb_, d1twhc1, d1twhc2, d1twhe2, d1twhf_, d1twhh_, d1twhi1, d1twhi2, d1twhj_, d1twhk_, d1twhl_ complexed with atp, mn, zn |
PDB Entry: 1twh (more details), 3.4 Å
SCOP Domain Sequences for d1twhe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1twhe1 c.52.3.1 (E:1-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsf
qanpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsa
mklvpsippatietfneaalvvn
Timeline for d1twhe1: