SCOP 1.73: Domain d1twhc2: 1twh C:42-172

Lineage for d1twhc2 (1twh C:42-172)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
   unusual fold; contains a left-handed beta-alpha-beta unit

4. Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family)

5. Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)

6. Protein RPB3 [64462] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64463] (24 PDB entries)

8. Domain d1twhc2: 1twh C:42-172 [112754]
   Other proteins in same PDB: d1twha_, d1twhb_, d1twhc1, d1twhe1, d1twhe2, d1twhf_, d1twhh_, d1twhi1, d1twhi2, d1twhj_, d1twhk_, d1twhl_
   complexed with atp, mn, zn

Details for d1twhc2

PDB Entry: 1twh, 3.4 Å

PDB Description: RNA polymerase II complexed with 2'dATP

PDB Compounds: (C:) DNA-directed RNA polymerase II 45 kDa polypeptide

SCOP Domain Sequences for d1twhc2:

Sequence; same for both SEQRES and ATOM records:

>d1twhc2 d.181.1.1 (C:42-172) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ptlaidsvevetnttvladefiahrlgliplqsmdieqleysrdcfcedhcdkcsvvltl
qafgesesttnvyskdlvivsnlmgrnighpiiqdkegngvlicklrkgqelkltcvakk
giakehakwgp

Timeline for d1twhc2:

• d1twhc2 first appeared in SCOP 1.71
  
• d1twhc2 appears in SCOP 1.75
  
• d1twhc2 appears in the current release, SCOPe 2.08