Lineage for d1twhc2 (1twh C:42-172)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 739032Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. 739033Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
  5. 739034Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)
  6. 739087Protein RPB3 [64462] (1 species)
  7. 739088Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64463] (24 PDB entries)
  8. 739096Domain d1twhc2: 1twh C:42-172 [112754]
    Other proteins in same PDB: d1twha_, d1twhb_, d1twhc1, d1twhe1, d1twhe2, d1twhf_, d1twhh_, d1twhi1, d1twhi2, d1twhj_, d1twhk_, d1twhl_
    complexed with atp, mn, zn

Details for d1twhc2

PDB Entry: 1twh (more details), 3.4 Å

PDB Description: RNA polymerase II complexed with 2'dATP
PDB Compounds: (C:) DNA-directed RNA polymerase II 45 kDa polypeptide

SCOP Domain Sequences for d1twhc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1twhc2 d.181.1.1 (C:42-172) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ptlaidsvevetnttvladefiahrlgliplqsmdieqleysrdcfcedhcdkcsvvltl
qafgesesttnvyskdlvivsnlmgrnighpiiqdkegngvlicklrkgqelkltcvakk
giakehakwgp

SCOP Domain Coordinates for d1twhc2:

Click to download the PDB-style file with coordinates for d1twhc2.
(The format of our PDB-style files is described here.)

Timeline for d1twhc2: