SCOPe 2.05: Domain d1twhc1: 1twh C:3-41,C:173-268

Lineage for d1twhc1 (1twh C:3-41,C:173-268)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.74: DCoH-like [55247] (5 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families)
   form homo and heterodimers

5. Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)

6. Protein RPB3 [64315] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64316] (24 PDB entries)
   Uniprot P16370; part of multichain biological unit

8. Domain d1twhc1: 1twh C:3-41,C:173-268 [112753]
   Other proteins in same PDB: d1twha_, d1twhb_, d1twhc2, d1twhe1, d1twhe2, d1twhf_, d1twhh_, d1twhi1, d1twhi2, d1twhj_, d1twhk_, d1twhl_
   protein/RNA complex; complexed with atp, mn, zn

Details for d1twhc1

PDB Entry: 1twh, 3.4 Å

PDB Description: RNA polymerase II complexed with 2'dATP

PDB Compounds: (C:) DNA-directed RNA polymerase II 45 kDa polypeptide

SCOPe Domain Sequences for d1twhc1:

Sequence; same for both SEQRES and ATOM records:

>d1twhc1 d.74.3.1 (C:3-41,C:173-268) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eegpqvkireaskdnvdfilsnvdlamanslrrvmiaeiXaaaiefeydpwnklkhtdyw
yeqdsakewpqsknceyedppnegdpfdykaqadtfymnvesvgsipvdqvvvrgidtlq
kkvasillaltqmdqd

Timeline for d1twhc1:

• d1twhc1 first appeared in SCOP 1.71
  
• d1twhc1 appears in SCOPe 2.04
  
• d1twhc1 appears in SCOPe 2.06
  
• d1twhc1 appears in the current release, SCOPe 2.08