Lineage for d1twhc1 (1twh C:3-41,C:173-268)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 865191Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 865274Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families) (S)
    form homo and heterodimers
  5. 865275Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)
  6. 865328Protein RPB3 [64315] (1 species)
  7. 865329Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64316] (24 PDB entries)
    Uniprot P16370; part of multichain biological unit
  8. 865338Domain d1twhc1: 1twh C:3-41,C:173-268 [112753]
    Other proteins in same PDB: d1twha_, d1twhb_, d1twhc2, d1twhe1, d1twhe2, d1twhf_, d1twhh_, d1twhi1, d1twhi2, d1twhj_, d1twhk_, d1twhl_
    complexed with atp, mn, zn

Details for d1twhc1

PDB Entry: 1twh (more details), 3.4 Å

PDB Description: RNA polymerase II complexed with 2'dATP
PDB Compounds: (C:) DNA-directed RNA polymerase II 45 kDa polypeptide

SCOP Domain Sequences for d1twhc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1twhc1 d.74.3.1 (C:3-41,C:173-268) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eegpqvkireaskdnvdfilsnvdlamanslrrvmiaeiXaaaiefeydpwnklkhtdyw
yeqdsakewpqsknceyedppnegdpfdykaqadtfymnvesvgsipvdqvvvrgidtlq
kkvasillaltqmdqd

SCOP Domain Coordinates for d1twhc1:

Click to download the PDB-style file with coordinates for d1twhc1.
(The format of our PDB-style files is described here.)

Timeline for d1twhc1: