Lineage for d1twha_ (1twh A:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2249905Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 2249906Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 2249995Family e.29.1.2: RNA-polymerase beta-prime [64490] (3 proteins)
  6. 2249996Protein RBP1 [64486] (2 species)
  7. 2249997Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64487] (24 PDB entries)
    Uniprot P04050; part of multichain biological unit
  8. 2250004Domain d1twha_: 1twh A: [112751]
    Other proteins in same PDB: d1twhb_, d1twhc1, d1twhc2, d1twhe1, d1twhe2, d1twhf_, d1twhh_, d1twhi1, d1twhi2, d1twhj_, d1twhk_, d1twhl_
    protein/RNA complex; complexed with atp, mn, zn

Details for d1twha_

PDB Entry: 1twh (more details), 3.4 Å

PDB Description: RNA polymerase II complexed with 2'dATP
PDB Compounds: (A:) DNA-directed RNA polymerase II largest subunit

SCOPe Domain Sequences for d1twha_:

Sequence, based on SEQRES records: (download)

>d1twha_ e.29.1.2 (A:) RBP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gqqyssaplrtvkevqfglfspeevraisvakirfpetmdetqtrakigglndprlgsid
rnlkcqtcqegmnecpghfghidlakpvfhvgfiakikkvcecvcmhcgkllldehnelm
rqalaikdskkrfaaiwtlcktkmvcetdvpseddptqlvsrggcgntqptirkdglklv
gswkkdratgdadepelrvlsteeilnifkhisvkdftslgfnevfsrpewmiltclpvp
pppvrpsisfnesqrgeddltfkladilkanisletlehngaphhaieeaesllqfhvat
ymdndiagqpqalqksgrpvksirarlkgkegrirgnlmgkrvdfsartvisgdpnleld
qvgvpksiaktltypevvtpynidrltqlvrngpnehpgakyvirdsgdridlryskrag
diqlqygwkverhimdndpvlfnrqpslhkmsmmahrvkvipystfrlnlsvtspynadf
dgdemnlhvpqseetraelsqlcavplqivspqsnkpcmgivqdtlcgirkltlrdtfie
ldqvlnmlywvpdwdgviptpaiikpkplwsgkqilsvaipngihlqrfdegttllspkd
ngmliidgqiifgvvekktvgssngglihvvtrekgpqvcaklfgniqkvvnfwllhngf
stgigdtiadgptmreitetiaeakkkvldvtkeaqanlltakhgmtlresfednvvrfl
neardkagrlaevnlkdlnnvkqmvmagskgsfiniaqmsacvgqqsvegkriafgfvdr
tlphfskddyspeskgfvensylrgltpqefffhamggreglidtavktaetgyiqrrlv
kaledimvhydnttrnslgnviqfiygedgmdaahiekqsldtiggsdaafekryrvdll
ntdhtldpsllesgseilgdlklqvlldeeykqlvkdrkflrevfvdgeanwplpvnirr
iiqnaqqtfhidhtkpsdltikdivlgvkdlqenllvlrgkneiiqnaqrdavtlfccll
rsrlatrrvlqeyrltkqafdwvlsnieaqflrsvvhpgemvgvlaaqsigepatqmtln
tfhfagvaskkvtsgvprlkeilnvaknmktpsltvylepghaadqeqaklirsaiehtt
lksvtiaseiyydpdprstvipedeeiiqlhfslldeeaeqsfdqqspwllrleldraam
ndkdltmgqvgerikqtfkndlfviwsedndekliircrvvrpksldaeteaeedhmlkk
ientmlenitlrgveniervvmmkydrkvpsptgeyvkepewvletdgvnlsevmtvpgi
dptriytnsfidimevlgieagraalykevynviasdgsyvnyrhmallvdvmttqgglt
svtrhgfnrsntgalmrcsfeetveilfeagasaelddcrgvsenvilgqmapigtgafd
vmideesl

Sequence, based on observed residues (ATOM records): (download)

>d1twha_ e.29.1.2 (A:) RBP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gqqyssaplrtvkevqfglfspeevraisvakirfpetmdetqtrakigglndprlgsid
rnlkcqtcqegmnecpghfghidlakpvfhvgfiakikkvcecvcmhcgkllldehnelm
rqalaikdskkrfaaiwtlcktkmvcetdvpseddptqlvsrggcgntqptirkdglklv
gswkkdratgdadepelrvlsteeilnifkhisvkdftslgfnevfsrpewmiltclpvp
pppvrpdltfkladilkanisletlehngaphhaieeaesllqfhvatymdsiradfsar
tvisgdpnleldqvgvpksiaktltypevvtpynidrltqlvrngpnehpgakyvirdsg
dridlryskragdiqlqygwkverhimdndpvlfnrqpslhkmsmmahrvkvipystfrl
nlsvtspynadfdgdemnlhvpqseetraelsqlcavplqivspqsnkpcmgivqdtlcg
irkltlrdtfieldqvlnmlywvpdwdgviptpaiikpkplwsgkqilsvaipngihlqr
fdegttllspkdngmliidgqiifgvvekktvgssngglihvvtrekgpqvcaklfgniq
kvvnfwllhngfstgigdtiadgptmreitetiaeakkkvldvtkeaqanlltakhgmtl
resfednvvrflneardkagrlaevnlkdlnnvkqmvmagskgsfiniaqmsacvgqqsv
egkriafgfvdrtlphfskddyspeskgfvensylrgltpqefffhamggreglidtavk
taetgyiqrrlvkaledimvhydnttrnslgnviqfiygedgmdaahiekqsldtiggsd
aafekryrvdllntdhtldpsllesgseilgdlklqvlldeeykqlvkdrkflrevfvdg
eanwplpvnirriiqnaqqtfhidhtkpsdltikdivlgvkdlqenllvlrgkneiiqna
qrdavtlfccllrsrlatrrvlqeyrltkqafdwvlsnieaqflrsvvhpgemvgvlaaq
sigepatqmtlkkvtsgvprlkeilnvaknmktpsltvylepghaadqeqaklirsaieh
ttlksvtiaseiyydpdprstvipedeeiiqlhlqqspwllrleldraamndkdltmgqv
gerikqtfkndlfviwsedndekliircrvvaeedhmlkkientmlenitlrgvenierv
vmmkydrkvpsptgeyvkepewvletdgvnlsevmtvpgidptriytnsfidimevlgie
agraalykevynviasdgsyvnyrhmallvdvmttqggltsvttveilfeagasaelddc
rgvsenvilgqmapigtgafdvmideesl

SCOPe Domain Coordinates for d1twha_:

Click to download the PDB-style file with coordinates for d1twha_.
(The format of our PDB-style files is described here.)

Timeline for d1twha_: